CacheBy
Atlas Antibodies Anti-CCNA1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CCNA1 Antibody

상품 한눈에 보기

인간 CCNA1 단백질에 특이적인 폴리클로날 항체로, cyclin A1 연구에 적합합니다. 토끼에서 생산된 IgG 형식이며, 친화 정제 방식으로 제조되었습니다. 다양한 응용 실험에 사용 가능하며, 인간에서 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA060646-100 Anti-CCNA1 Antibody, cyclin A1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA060646-25 Anti-CCNA1 Antibody, cyclin A1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CCNA1 Antibody

Anti-CCNA1 Antibody

Target Information

  • Target Protein: cyclin A1
  • Target Gene: CCNA1
  • Alternative Gene Names: CT146

Product Description

Polyclonal antibody against human CCNA1 (cyclin A1).
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.

  • Immunocytochemistry (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

GWGEEYLSWEGPGLPDFVFQQPVESEAMHCSNPKSGVVLATVARGPDACQILTRAPLGQDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKKALPDC

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000027793 54%
Rat ENSRNOG00000014052 53%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference Documents

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.