Atlas Antibodies Anti-CCK Antibody

상품 한눈에 보기

Human CCK 단백질을 인식하는 폴리클로날 항체로, IHC 기반 정량 분석 및 RNA-seq 데이터와의 정합 검증에 적합. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제됨. 인간, 마우스, 랫트 간 교차 반응성 확인됨.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA069515-100 Anti-CCK Antibody, cholecystokinin 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA069515-25 Anti-CCK Antibody, cholecystokinin 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-CCK Antibody

Anti-CCK Antibody

Target: cholecystokinin (CCK)
Type: Polyclonal Antibody against Human CCK

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

This polyclonal antibody is raised in rabbit against the human cholecystokinin (CCK) protein. It is affinity purified using the PrEST antigen as the affinity ligand.

Open Datasheet

Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
```
LQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMG
```

Species Reactivity

Verified Species: Human
Interspecies Identity:
- Mouse (ENSMUSG00000032532): 84%
- Rat (ENSRNOG00000019321): 82%

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol, PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using PrEST antigen
Storage & Handling	Gently mix before use. Optimal concentration and conditions should be determined by the user.
Safety	Material Safety Data Sheet