CacheBy
Atlas Antibodies Anti-CCL19 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CCL19 Antibody

상품 한눈에 보기

인간 CCL19 단백질을 대상으로 한 고품질 폴리클로날 항체입니다. IHC 등 단백질 발현 검증에 적합하며, RNA-seq 데이터 기반의 정교한 orthogonal validation을 지원합니다. 토끼 유래 IgG로, PrEST 항원 친화 정제 방식으로 고순도 확보.

카탈로그번호
HPA067758-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA067758-100 Anti-CCL19 Antibody, chemokine (C-C motif) ligand 19 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA067758-25 Anti-CCL19 Antibody, chemokine (C-C motif) ligand 19 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CCL19 Antibody

Anti-CCL19 Antibody

Target: chemokine (C-C motif) ligand 19
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human CCL19


Alternative Gene Names

CKb11, ELC, exodus-3, MIP-3b, SCYA19

Open Datasheet


Specifications

항목 내용
Target Protein chemokine (C-C motif) ligand 19
Target Gene CCL19
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence LLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000094661 (76%), Rat ENSRNOG00000015668 (76%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet


제품 이미지

Enhanced Validation
IHC Orthogonal
Tooltip Orthogonal

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.