Thermo Fisher Scientific Calmyrin Polyclonal Antibody
Calmyrin 단백질을 인식하는 Rabbit Polyclonal 항체로, Human 시료에 반응합니다. ICC/IF 실험에 적합하며, 항원 친화 크로마토그래피로 정제되었습니다. PBS(40% glycerol) 완충액에 보관되며, 연구용으로만 사용 가능합니다.
- 카탈로그번호
- PA583931
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific Calmyrin Polyclonal Antibody
Applications
Immunocytochemistry (ICC/IF)
- Tested Dilution: 0.25–2 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant protein corresponding to Human CIB1. Recombinant protein control fragment (Product # RP-104864) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 1 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS, pH 7.2, with 40% glycerol |
| Contains | 0.02% sodium azide |
| Storage conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping conditions | Wet ice |
| RRID | AB_2791083 |
Product Specific Information
Immunogen sequence:
DIKSHYAFRIFDFDDDGTLNREDLSRLVNCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRSPDFASSF
Target Information
The protein encoded by this gene is a member of the calcium-binding protein family. The specific function of this protein has not yet been determined; however, it is known to interact with DNA-dependent protein kinase and may play a role in kinase-phosphatase regulation of DNA end joining. This protein also interacts with integrin alphabeta, suggesting a possible regulatory role for alphabeta.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.