Thermo Fisher Scientific Calmyrin Polyclonal Antibody
Calmyrin 단백질을 인식하는 Rabbit Polyclonal 항체로, Human 시료에 반응합니다. ICC/IF 실험에 적합하며, 항원 친화 크로마토그래피로 정제되었습니다. PBS(40% glycerol) 완충액에 보관되며, 연구용으로만 사용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Immunocytochemistry (ICC/IF)
- Tested Dilution: 0.25–2 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant protein corresponding to Human CIB1. Recombinant protein control fragment (Product # RP-104864) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 1 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS, pH 7.2, with 40% glycerol |
| Contains | 0.02% sodium azide |
| Storage conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping conditions | Wet ice |
| RRID | AB_2791083 |
Product Specific Information
Immunogen sequence:
DIKSHYAFRIFDFDDDGTLNREDLSRLVNCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRSPDFASSF
Target Information
The protein encoded by this gene is a member of the calcium-binding protein family. The specific function of this protein has not yet been determined; however, it is known to interact with DNA-dependent protein kinase and may play a role in kinase-phosphatase regulation of DNA end joining. This protein also interacts with integrin alphabeta, suggesting a possible regulatory role for alphabeta.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific MDMX Polyclonal Antibody
740,000원
Thermo Fisher Scientific
Thermo Fisher Scientific EPHX1 Polyclonal Antibody
761,500원
Thermo Fisher Scientific
Thermo Fisher Scientific Calmyrin Polyclonal Antibody
740,000원
Thermo Fisher Scientific
Thermo Fisher Scientific BOLL Polyclonal Antibody
761,500원
Thermo Fisher Scientific
Thermo Fisher Scientific DDX41 Polyclonal Antibody
740,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|