CacheBy
Thermo Fisher Scientific LAF4 Polyclonal Antibody
원본

Thermo Fisher Scientific LAF4 Polyclonal Antibody

상품 한눈에 보기

LAF4 단백질을 인식하는 Rabbit Polyclonal Antibody로 Western Blot에 적합합니다. 인간 LAF4 중간 영역을 기반으로 제작되었으며, 다양한 종에서 높은 상동성을 보입니다. 액상 형태로 제공되며, -20°C에서 보관합니다.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오후 02:44
Thermo Fisher Scientific PA568961 LAF4 Polyclonal Antibody 100 ul pk판매 단위 pk ·
재고 확인 필요
642,300원VAT 포함 706,530원

Thermo Fisher Scientific · Thermo Fisher Scientific LAF4 Polyclonal Antibody

Applications

Western Blot (WB)

  • Tested Dilution: 1.0 µg/mL

Product Specifications

항목 내용
Species Reactivity Mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen Synthetic peptide directed towards the middle region of human LAF4 (aa 1193-1242)
Conjugate Unconjugated
Form Liquid
Concentration 0.5 mg/mL
Purification Affinity chromatography
Storage Buffer PBS with 2% sucrose
Contains 0.09% sodium azide
Storage Conditions -20°C, Avoid Freeze/Thaw Cycles
Shipping Conditions Wet ice
RRID AB_2691087

Product Specific Information

This target displays homology in the following species:
Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%

Synthetic peptide located within the following region:
TNSILHSYDYWEMADNLAKENREFFNDLDLLMGPVTLHSSMEHLVQYSQQ


Target Information

This gene encodes a tissue-restricted nuclear transcriptional activator that is preferentially expressed in lymphoid tissue. Isolation of this protein initially defined a highly conserved LAF4/MLLT2 gene family of nuclear transcription factors that may function in lymphoid development and oncogenesis. In some ALL patients, this gene has been found fused to the gene for MLL. Multiple alternatively spliced transcript variants that encode different proteins have been found for this gene.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.