원본
Thermo Fisher Scientific CD127 Polyclonal Antibody
상품 한눈에 보기
CD127(IL7Rα)을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody로, Human 및 Rat 시료에 반응합니다. Western blot과 Flow cytometry에 적합하며, 항원 친화 크로마토그래피로 정제되었습니다. 연구용으로만 사용 가능합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오전 09:42
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA579511 CD127 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific CD127 Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Flow Cytometry (Flow)
- Tested Dilution: 1–3 µg/1×10^6 cells
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human IL7R alpha (278–315aa DHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQ) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746627 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
CD127 (Interleukin-7 receptor alpha, IL7Rα)는 림포포이에시스 조절에 관여하는 당단백질입니다. 활성 수용체는 α/γ 체인 헤테로다이머 형태로 존재하며, γ(c) 체인은 신호전달을 담당하고 α 체인은 세포 내 신호 분자와 결합하여 특이적 신호를 매개합니다. CD127은 전구 B 세포, 흉선세포, T 세포 전구체 및 성숙한 CD4+, CD8+ T 세포의 증식을 촉진합니다. CD127 기능 이상은 중증 복합 면역결핍증(SCID) 등과 관련이 있습니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific IL-7 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific IL-7 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific IL-4 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific IL-4 Polyclonal Antibody568,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.