
Thermo Fisher Scientific CD127 Polyclonal Antibody
CD127(IL7Rα)을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody로, Human 및 Rat 시료에 반응합니다. Western blot과 Flow cytometry에 적합하며, 항원 친화 크로마토그래피로 정제되었습니다. 연구용으로만 사용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Flow Cytometry (Flow)
- Tested Dilution: 1–3 µg/1×10^6 cells
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human IL7R alpha (278–315aa DHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQ) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746627 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
CD127 (Interleukin-7 receptor alpha, IL7Rα)는 림포포이에시스 조절에 관여하는 당단백질입니다. 활성 수용체는 α/γ 체인 헤테로다이머 형태로 존재하며, γ(c) 체인은 신호전달을 담당하고 α 체인은 세포 내 신호 분자와 결합하여 특이적 신호를 매개합니다. CD127은 전구 B 세포, 흉선세포, T 세포 전구체 및 성숙한 CD4+, CD8+ T 세포의 증식을 촉진합니다. CD127 기능 이상은 중증 복합 면역결핍증(SCID) 등과 관련이 있습니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific IL-7 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific IL-7 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific CD127 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific IL-4 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific IL-4 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|