Thermo Fisher Scientific eIF3d Polyclonal Antibody
Human eIF3d 단백질을 인식하는 Rabbit Polyclonal Antibody로 Western blot, IHC, ICC/IF에 적합. 항원 친화 크로마토그래피로 정제되어 높은 특이성과 안정성 제공. 단기 4°C, 장기 -20°C 보관 권장.
- 카탈로그번호
- PA564268
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific eIF3d Polyclonal Antibody
Applications
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.04–0.4 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 1:500–1:1,000 |
| Immunocytochemistry (ICC/IF) | 0.25–2 µg/mL |
Product Specifications
| Property | Description |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant protein corresponding to Human eIF3d. Recombinant protein control fragment (Product #RP-103625). |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.1 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS, pH 7.2, with 40% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2640963 |
Product Specific Information
Immunogen sequence:
PQDIECCGALEYYDKAFDRITTRSEKPLRSIKRIFHTVTTTDDPVIRKLATQGNVFATDAILATLMSCTRSVYSWDI
Highest antigen sequence identity to the following orthologs:
- Mouse: 100%
- Rat: 100%
Target Information
eIF3D is a protein belonging to the largest of the eukaryotic translation initiation factor family, eukaryotic translation initiation factor-3 (eIF3). eIF3 is a multiprotein complex composed of at least 13 different subunits. eIF3D binds to the 40S ribosomal subunit and helps maintain the 40S and 60S ribosomal subunits in a dissociated state. It plays an important role in the formation of the 40S initiation complex by interacting with the ternary complex of eIF2/GTP/methionyl-tRNA, promoting mRNA binding. eIF3D is the major RNA-binding subunit of the eIF3 complex and associates with the subunit p170 of eIF-3. Ubiquitous expression of eIF3D is seen in most tissues, and it is phosphorylated upon DNA damage, likely by ATM or ATR.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.