AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CC2D2B Antibody
상품 한눈에 보기
인간 CC2D2B 단백질을 인식하는 폴리클로날 항체로, IHC 및 오쏘고날 검증에 적합. Rabbit 유래 IgG 항체이며, PrEST 항원으로 정제됨. 높은 특이성과 재현성을 제공하며, RNA-seq 데이터 기반 단백질 발현 비교 검증 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA072122-100 Anti-CC2D2B Antibody, coiled-coil and C2 domain containing 2B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA072122-25 Anti-CC2D2B Antibody, coiled-coil and C2 domain containing 2B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CC2D2B Antibody
Anti-CC2D2B Antibody
Target: Coiled-coil and C2 domain containing 2B
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against human CC2D2B.
Alternative Gene Names
bA248J23.4, C10orf130
Antigen Information
Antigen Sequence (Recombinant Protein Epitope Signature Tag, PrEST):
VPSSSPVVNQRKLPKDMMPRILEDEGFYIQRKPEIYKKTCNKMENRLLKLEEGKCWFGESGEIMSLPTPIKQSWNF
Species Reactivity
Verified Species: Human
Interspecies Information:
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000108929 | 78% |
| Rat | ENSRNOG00000059715 | 45% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Material Safety Data Sheet (Sodium Azide)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.