
Atlas Antibodies Anti-CC2D2B Antibody
인간 CC2D2B 단백질을 인식하는 폴리클로날 항체로, IHC 및 오쏘고날 검증에 적합. Rabbit 유래 IgG 항체이며, PrEST 항원으로 정제됨. 높은 특이성과 재현성을 제공하며, RNA-seq 데이터 기반 단백질 발현 비교 검증 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CC2D2B Antibody
Target: Coiled-coil and C2 domain containing 2B
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against human CC2D2B.
Alternative Gene Names
bA248J23.4, C10orf130
Antigen Information
Antigen Sequence (Recombinant Protein Epitope Signature Tag, PrEST):
VPSSSPVVNQRKLPKDMMPRILEDEGFYIQRKPEIYKKTCNKMENRLLKLEEGKCWFGESGEIMSLPTPIKQSWNF
Species Reactivity
Verified Species: Human
Interspecies Information:
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000108929 | 78% |
| Rat | ENSRNOG00000059715 | 45% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Material Safety Data Sheet (Sodium Azide)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CC2D1B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CCAR1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CC2D2B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CC2D2A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CC2D1B Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|