
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CCAR1 Antibody
상품 한눈에 보기
Human CCAR1 단백질을 인식하는 Rabbit Polyclonal Antibody. IHC 및 WB에 적합하며, 높은 종간 반응성(인간, 마우스, 랫트)을 보임. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공. 실험 조건은 사용자 최적화 필요.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA007856-100 Anti-CCAR1 Antibody, cell division cycle and apoptosis regulator 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA007856-25 Anti-CCAR1 Antibody, cell division cycle and apoptosis regulator 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CCAR1 Antibody
Anti-CCAR1 Antibody
Target: Cell division cycle and apoptosis regulator 1 (CCAR1)
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human CCAR1.
Alternative Gene Names
CARP-1, CARP1, FLJ10590
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Cell division cycle and apoptosis regulator 1 |
| Target Gene | CCAR1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Rat ENSRNOG00000000397 (94%), Mouse ENSMUSG00000020074 (93%) |
Antigen Sequence:
KDVEENVGLIVYNGAMVDVGSLLQKLEKSEKVRAEVEQKLQLLEEKTDEDEKTILNLENSNKSLSGELREVKKDLSQLQENLKISENMNLQFENQMNKTIRNLSTVMDEIHTVLKKDNVKNED
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



