Atlas Antibodies Anti-CCAR1 Antibody

상품 한눈에 보기

Human CCAR1 단백질을 인식하는 Rabbit Polyclonal Antibody. IHC 및 WB에 적합하며, 높은 종간 반응성(인간, 마우스, 랫트)을 보임. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공. 실험 조건은 사용자 최적화 필요.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA007856-100 Anti-CCAR1 Antibody, cell division cycle and apoptosis regulator 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA007856-25 Anti-CCAR1 Antibody, cell division cycle and apoptosis regulator 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Cell division cycle and apoptosis regulator 1 (CCAR1)

Polyclonal antibody against human CCAR1.

CARP-1, CARP1, FLJ10590

항목	내용
Target Protein	Cell division cycle and apoptosis regulator 1
Target Gene	CCAR1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Identity	Rat ENSRNOG00000000397 (94%), Mouse ENSMUSG00000020074 (93%)

Antigen Sequence:
KDVEENVGLIVYNGAMVDVGSLLQKLEKSEKVRAEVEQKLQLLEEKTDEDEKTILNLENSNKSLSGELREVKKDLSQLQENLKISENMNLQFENQMNKTIRNLSTVMDEIHTVLKKDNVKNED

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen as affinity ligand