CacheBy
Atlas Antibodies Anti-CARMIL3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CARMIL3 Antibody

상품 한눈에 보기

Human CARMIL3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 40% 글리세롤/PBS 완충액에 보존. 사람에 대해 검증되었으며 쥐, 생쥐와 높은 서열 유사성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030596-100 Anti-CARMIL3 Antibody, capping protein regulator and myosin 1 linker 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030596-25 Anti-CARMIL3 Antibody, capping protein regulator and myosin 1 linker 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CARMIL3 Antibody

Anti-CARMIL3 Antibody

Target: capping protein regulator and myosin 1 linker 3 (CARMIL3)
Clonality: Polyclonal
Host: Rabbit
Isotype: IgG
Recommended Applications: IHC (Immunohistochemistry)


Product Description

Polyclonal antibody against human CARMIL3.

Alternative Gene Names

BC008134, C14orf121, crml-1, LRRC16B

Open Datasheet


Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

CDYNGLHCREEVQWDVDTIYHAEDNREFNLLDFSHLESRDLALMVAALAYNQWFTKLYCKDLRLGSEVLEQVLHTLSKSGSLEELVLDNAGLKTDFVQKLAGVFGENGSCVLHALTL

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to orthologs:

  • Rat ENSRNOG00000025518 (100%)
  • Mouse ENSMUSG00000022211 (99%)

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Purification Method

Affinity purified using the PrEST antigen as affinity ligand.


Notes

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.