
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CARMIL1 Antibody
상품 한눈에 보기
Human CARMIL1 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC 및 ICC 응용에 적합하며 RNA-seq 데이터 기반 Orthogonal validation 제공. Rabbit host, IgG isotype, Affinity purified 제품.
- 카탈로그번호
- HPA029039-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA029039-100 Anti-CARMIL1 Antibody, capping protein regulator and myosin 1 linker 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029039-25 Anti-CARMIL1 Antibody, capping protein regulator and myosin 1 linker 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CARMIL1 Antibody
Anti-CARMIL1 Antibody
Target Protein: capping protein regulator and myosin 1 linker 1
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation)
- ICC
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human CARMIL1
Alternative Gene Names
CARMIL, dJ501N12.1, FLJ20048, LRRC16, LRRC16A
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
HKLADHFSRRGKTLPQQESLEIELAEEKPVKRSIITVEELTEIERLEDLDTCMMTPKSKRKSIHSRMLRPVSRAFEMEFDL
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000021338 | 84% |
| Rat | ENSRNOG00000016576 | 83% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



