CacheBy
Atlas Antibodies Anti-CARMIL1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CARMIL1 Antibody

상품 한눈에 보기

Human CARMIL1 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC 및 ICC 응용에 적합하며 RNA-seq 데이터 기반 Orthogonal validation 제공. Rabbit host, IgG isotype, Affinity purified 제품.

카탈로그번호
HPA029039-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA029039-100 Anti-CARMIL1 Antibody, capping protein regulator and myosin 1 linker 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029039-25 Anti-CARMIL1 Antibody, capping protein regulator and myosin 1 linker 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CARMIL1 Antibody

Anti-CARMIL1 Antibody

Target Protein: capping protein regulator and myosin 1 linker 1
Supplier: Atlas Antibodies

  • IHC (Orthogonal validation)
  • ICC

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human CARMIL1

Alternative Gene Names

CARMIL, dJ501N12.1, FLJ20048, LRRC16, LRRC16A

Open Datasheet

Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    HKLADHFSRRGKTLPQQESLEIELAEEKPVKRSIITVEELTEIERLEDLDTCMMTPKSKRKSIHSRMLRPVSRAFEMEFDL

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000021338 84%
Rat ENSRNOG00000016576 83%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Tooltip Orthogonal
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.