
Atlas Antibodies Anti-CARMIL1 Antibody
Human CARMIL1 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC 및 ICC 응용에 적합하며 RNA-seq 데이터 기반 Orthogonal validation 제공. Rabbit host, IgG isotype, Affinity purified 제품.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CARMIL1 Antibody
Target Protein: capping protein regulator and myosin 1 linker 1
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation)
- ICC
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human CARMIL1
Alternative Gene Names
CARMIL, dJ501N12.1, FLJ20048, LRRC16, LRRC16A
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
HKLADHFSRRGKTLPQQESLEIELAEEKPVKRSIITVEELTEIERLEDLDTCMMTPKSKRKSIHSRMLRPVSRAFEMEFDL
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000021338 | 84% |
| Rat | ENSRNOG00000016576 | 83% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CARNMT1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CARMIL3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CARMIL1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CARMIL1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CARM1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|