CacheBy
Atlas Antibodies Anti-CAPNS2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CAPNS2 Antibody

상품 한눈에 보기

Human CAPNS2 단백질을 표적으로 하는 폴리클로날 항체. Rabbit 유래 IgG로, PrEST 항원으로 친화 정제됨. ICC 등 다양한 응용에 적합하며, Human 반응성 검증 완료. PBS/glycerol buffer에 sodium azide 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA059749-100 Anti-CAPNS2 Antibody, calpain small subunit 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059749-100 Anti-CAPNS2 Antibody, calpain small subunit 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CAPNS2 Antibody

Anti-CAPNS2 Antibody

Target Information

  • Target Protein: Calpain small subunit 2
  • Target Gene: CAPNS2
  • Alternative Gene Names: MGC12536, MGC14804
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human CAPNS2.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
KWQCVYKQYDRDHSGSLGSSQLRGALQAAGFQLNEQLYQMIVRRYANEDGD

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000078144 86%
Rat ENSRNOG00000045747 55%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet

Usage Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.