
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CAPNS2 Antibody
상품 한눈에 보기
Human CAPNS2 단백질을 표적으로 하는 폴리클로날 항체. Rabbit 유래 IgG로, PrEST 항원으로 친화 정제됨. ICC 등 다양한 응용에 적합하며, Human 반응성 검증 완료. PBS/glycerol buffer에 sodium azide 보존제 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA059749-100 Anti-CAPNS2 Antibody, calpain small subunit 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059749-100 Anti-CAPNS2 Antibody, calpain small subunit 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CAPNS2 Antibody
Anti-CAPNS2 Antibody
Target Information
- Target Protein: Calpain small subunit 2
- Target Gene: CAPNS2
- Alternative Gene Names: MGC12536, MGC14804
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human CAPNS2.
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:KWQCVYKQYDRDHSGSLGSSQLRGALQAAGFQLNEQLYQMIVRRYANEDGD
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000078144 | 86% |
| Rat | ENSRNOG00000045747 | 55% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet
Usage Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



