
Atlas Antibodies Anti-CAPNS2 Antibody
상품 한눈에 보기
Human CAPNS2 단백질을 표적으로 하는 폴리클로날 항체. Rabbit 유래 IgG로, PrEST 항원으로 친화 정제됨. ICC 등 다양한 응용에 적합하며, Human 반응성 검증 완료. PBS/glycerol buffer에 sodium azide 보존제 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CAPNS2 Antibody
Target Information
- Target Protein: Calpain small subunit 2
- Target Gene: CAPNS2
- Alternative Gene Names: MGC12536, MGC14804
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human CAPNS2.
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:KWQCVYKQYDRDHSGSLGSSQLRGALQAAGFQLNEQLYQMIVRRYANEDGD
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000078144 | 86% |
| Rat | ENSRNOG00000045747 | 55% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet
Usage Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CAPNS1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CAPN9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CAPNS2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CAPN8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CAPN9 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.