CacheBy
Atlas Antibodies Anti-CAPN8 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CAPN8 Antibody

상품 한눈에 보기

인체 CAPN8 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 타입입니다. PrEST 항원으로 정제되었으며, Human에 반응성이 검증되었습니다. ICC 등 다양한 응용에 적합합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA073939-100 Anti-CAPN8 Antibody, calpain 8 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA073939-25 Anti-CAPN8 Antibody, calpain 8 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CAPN8 Antibody

Anti-CAPN8 Antibody

Target Information

  • Target Protein: calpain 8
  • Target Gene: CAPN8
  • Alternative Gene Names: nCL-2

Product Description

Polyclonal Antibody against Human CAPN8.

  • Immunocytochemistry (ICC)

OCR 텍스트: Recommended Applications: ICC

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

FDGFNINTCREMISLLDSNGTGTLGAVEFKTLWLKIQKYLEIYWETDYNHSGTIDAHEMRTAL

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000003468 (81%)
  • Mouse ENSMUSG00000038599 (81%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

참고 문서

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.