
Atlas Antibodies Anti-CAPN11 Antibody
상품 한눈에 보기
Human CAPN11 단백질을 표적으로 하는 Rabbit Polyclonal 항체로, IHC Orthogonal 검증을 통해 단백질 발현이 확인됨. Affinity purification으로 높은 특이도 확보. 다양한 연구용 응용에 적합. Glycerol 기반 buffer로 안정적 보관 가능.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CAPN11 Antibody
Target Protein: calpain 11
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human CAPN11
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | calpain 11 |
| Target Gene | CAPN11 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | WELDEVNYAEQLQEEKVSEDDMDQDFLHLFKIVAGEGKEIGVYELQRLLNRMAIKFKSFKTKGFGLDACRCMINLMDKDGSGK |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000058626 (59%), Rat ENSRNOG00000026025 (58%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CAPN13 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CAPN13 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CAPN11 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CAPN1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CAPG Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.