CacheBy
Atlas Antibodies Anti-CAPN13 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CAPN13 Antibody

상품 한눈에 보기

인간 CAPN13 단백질을 인식하는 토끼 폴리클로날 항체. 면역형광(ICC) 등 다양한 응용에 적합. PrEST 항원을 이용해 친화정제됨. 인간에 대한 반응성이 검증됨. 최적 조건은 사용자가 실험에 맞게 조정 필요.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030034-100 Anti-CAPN13 Antibody, calpain 13 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030034-25 Anti-CAPN13 Antibody, calpain 13 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CAPN13 Antibody

Anti-CAPN13 Antibody

Target Information

  • Target Protein: calpain 13
  • Target Gene: CAPN13
  • Alternative Gene Names: FLJ23523
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human CAPN13.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Antigen Sequence:
    DGEFWMSCQDFQQKFIAMFICSEIPITLDHGNTLHEGWSQIMFRKQVILGNTAGGPRNDAQFNFSVQEPMEGTNVVVCVTVAVTPSNLKAEDA

Species Reactivity

  • Verified Species: Human
  • Interspecies Information:
    • Rat ENSRNOG00000032375 (55%)
    • Mouse ENSMUSG00000043705 (55%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Storage Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Documents

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.