
Atlas Antibodies Anti-CALD1 Antibody
Human CALD1 단백질을 인식하는 고품질 폴리클로날 항체로, IHC 및 WB에서 RNA-seq 데이터 기반 정교한 orthogonal 검증 수행. Rabbit 유래 IgG 항체이며, 인체·마우스·랫트 반응성 확인. PrEST 항원으로 친화 정제된 고신뢰 연구용 시약.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CALD1 Antibody
Target Protein: caldesmon 1
Supplier: Atlas Antibodies
Recommended Applications
IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB (Western Blot)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human CALD1
Alternative Gene Names
CDM, H-CAD, L-CAD
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | caldesmon 1 |
| Target Gene | CALD1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Information | Rat ENSRNOG00000010233 (93%), Mouse ENSMUSG00000029761 (91%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Antigen Sequence
SLKIEERAEFLNKSVQKSSGVKSTHQAAIVSKIDSRLEQYTSAIEGTKSAKPTKPAASDLPVPAEGVRNIKSMWEKGNVFSSPTAAGTPNKETAGLKVGVSSRINEWLTKTPDGNKSPAPKPSDLRPGDVSSKRNLWEKQSVDKVTS제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CALML5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CALML4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CALD1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CALHM1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CALCRL Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|