CacheBy
Atlas Antibodies Anti-CALHM1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CALHM1 Antibody

상품 한눈에 보기

인간 CALHM1 단백질을 표적으로 하는 고품질 폴리클로날 항체. Rabbit 호스트에서 생산되어 높은 특이성과 재현성을 제공. IHC 등 다양한 생명과학 연구 응용에 적합. Affinity purification으로 높은 순도 확보. Human 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA061816-100 Anti-CALHM1 Antibody, calcium homeostasis modulator 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061816-25 Anti-CALHM1 Antibody, calcium homeostasis modulator 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CALHM1 Antibody

Anti-CALHM1 Antibody

Target: Calcium homeostasis modulator 1 (CALHM1)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human CALHM1.


Alternative Gene Names

  • FAM26C

Open Datasheet (PDF)


Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

CTEHAKAFAKVCIQQFFEAMNHDLELGHTHGTLATAPASAAAPTTPDGAEEEREKLRGITDQGTMNRLLTSWHKCKPPLRLGQEEPPLMGNGW

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Mouse ENSMUSG00000079258 82%
Rat ENSRNOG00000030682 80%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as ligand

Material Safety Data Sheet


  • Immunohistochemistry (IHC)

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.