Atlas Antibodies Anti-CABS1 Antibody

상품 한눈에 보기

인간 CABS1 단백질을 인식하는 토끼 폴리클로날 항체로, 정자 특이적 칼슘 결합 단백질 연구에 적합. IHC 정량 검증 완료. PrEST 항원을 이용한 친화 정제 제품으로 높은 특이성과 재현성을 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA044016-100 Anti-CABS1 Antibody, calcium-binding protein, spermatid-specific 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA044016-25 Anti-CABS1 Antibody, calcium-binding protein, spermatid-specific 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: calcium-binding protein, spermatid-specific 1

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal Antibody against Human CABS1

C4orf35, CLPH, FLJ32897, NYD-SP26

항목	내용
Target Protein	calcium-binding protein, spermatid-specific 1
Target Gene	CABS1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	GTTNSITRDSITEHFMPVKIGNISSPVTTVSLIDFSTDIAKEDILLATIDTGDAEISITSEVSGTLKDSSAGVADAPAFPRKKDEADMSNYNSSIKSNVP
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000001950 (59%), Mouse ENSMUSG00000007907 (58%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand