
Atlas Antibodies Anti-CABS1 Antibody
상품 한눈에 보기
인간 CABS1 단백질을 인식하는 토끼 폴리클로날 항체로, 정자 특이적 칼슘 결합 단백질 연구에 적합. IHC 정량 검증 완료. PrEST 항원을 이용한 친화 정제 제품으로 높은 특이성과 재현성을 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CABS1 Antibody
Target: calcium-binding protein, spermatid-specific 1
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human CABS1
Alternative Gene Names
C4orf35, CLPH, FLJ32897, NYD-SP26
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | calcium-binding protein, spermatid-specific 1 |
| Target Gene | CABS1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | GTTNSITRDSITEHFMPVKIGNISSPVTTVSLIDFSTDIAKEDILLATIDTGDAEISITSEVSGTLKDSSAGVADAPAFPRKKDEADMSNYNSSIKSNVP |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000001950 (59%), Mouse ENSMUSG00000007907 (58%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CABS1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CABYR Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CABS1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CABP7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CABP5 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.