CacheBy
Atlas Antibodies Anti-CABYR Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CABYR Antibody

상품 한눈에 보기

Human CABYR 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 RNA-seq 비교를 통한 Orthogonal Validation 수행. PrEST 항원으로 정제되어 높은 특이성과 재현성 제공. 40% 글리세롤/PBS 버퍼에 보존제로 소듐 아지드 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040703-100 Anti-CABYR Antibody, calcium binding tyrosine-(Y)-phosphorylation regulated 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040703-25 Anti-CABYR Antibody, calcium binding tyrosine-(Y)-phosphorylation regulated 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CABYR Antibody

Anti-CABYR Antibody

calcium binding tyrosine-(Y)-phosphorylation regulated


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human CABYR

Alternative Gene Names

CBP86, CT88, FSP-2

Open Datasheet


Target Information

항목 내용
Target Protein calcium binding tyrosine-(Y)-phosphorylation regulated
Target Gene CABYR
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Highest antigen sequence identity to orthologs:
Rat ENSRNOG00000047436 (56%)
Mouse ENSMUSG00000024430 (55%)

Antigen Sequence:

GKVSSIHSDQSDVLMVDVATSMPVVIKEVPSSEAAEDVMVAAPLVCSGKVLEVQVVNQTSVHVDLGSQPKENEAEPSTASSVPLQDEQEPPAY

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.