Atlas Antibodies Anti-C9orf78 Antibody
Human C9orf78 단백질을 표적으로 하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Orthogonal 및 Independent validation을 통해 높은 신뢰도의 단백질 발현 검증이 가능합니다. HCA59, HSPC220 대체 유전자명으로도 사용됩니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Atlas Antibodies · Atlas Antibodies Anti-C9orf78 Antibody
Anti-C9orf78 Antibody
Target: chromosome 9 open reading frame 78
Supplier: Atlas Antibodies
Recommended Applications
IHC (Orthogonal Validation)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB (Independent Validation)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human C9orf78
Alternative Gene Names: HCA59, HSPC220
Open Datasheet
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 9 open reading frame 78 |
| Target Gene | C9orf78 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Mouse ENSMUSG00000026851 (100%), Rat ENSRNOG00000007532 (100%) |
Antigen Sequence:
KKTEEMLSNQMLSGIPEVDLGIDAKIKNIISTEDAKARLLAEQQNKKKDSETSFVPTNMAVNYVQHNR
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.