
Atlas Antibodies Anti-C9orf78 Antibody
Human C9orf78 단백질을 표적으로 하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Orthogonal 및 Independent validation을 통해 높은 신뢰도의 단백질 발현 검증이 가능합니다. HCA59, HSPC220 대체 유전자명으로도 사용됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C9orf78 Antibody
Target: chromosome 9 open reading frame 78
Supplier: Atlas Antibodies
Recommended Applications
IHC (Orthogonal Validation)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB (Independent Validation)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human C9orf78
Alternative Gene Names: HCA59, HSPC220
Open Datasheet
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 9 open reading frame 78 |
| Target Gene | C9orf78 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Mouse ENSMUSG00000026851 (100%), Rat ENSRNOG00000007532 (100%) |
Antigen Sequence:
KKTEEMLSNQMLSGIPEVDLGIDAKIKNIISTEDAKARLLAEQQNKKKDSETSFVPTNMAVNYVQHNR
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CA1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C9orf85 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C9orf78 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C9orf78 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C9orf72 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|