AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-C9orf85 Antibody
상품 한눈에 보기
Human C9orf85 단백질을 인식하는 Rabbit Polyclonal 항체로, PrEST 항원으로 특이적으로 정제됨. Human에 반응하며, 40% glycerol 기반의 안정한 PBS buffer에 보존. ICC 등 다양한 연구 응용에 적합.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA050767-100 Anti-C9orf85 Antibody, chromosome 9 open reading frame 85 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050767-25 Anti-C9orf85 Antibody, chromosome 9 open reading frame 85 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C9orf85 Antibody
Anti-C9orf85 Antibody
Target: Chromosome 9 open reading frame 85 (C9orf85)
Type: Polyclonal Antibody against Human C9orf85
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human C9orf85, also known as chromosome 9 open reading frame 85.
Alternative Gene Names
- MGC61599
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Chromosome 9 open reading frame 85 |
| Target Gene | C9orf85 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | SSQKGNVARSRPQKHQNTFSFKNDKFDKSVQTKKINAKLHDGVCQRCKEVLEWRVKYSKYKPLS |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000035171 (97%), Rat ENSRNOG00000027161 (97%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.