
Atlas Antibodies Anti-C5orf22 Antibody
상품 한눈에 보기
Atlas Antibodies의 Anti-C5orf22 항체는 인간 C5orf22 단백질을 인식하는 토끼 폴리클로날 IgG 항체입니다. IHC, WB, ICC 등 다양한 응용에 적합하며, PrEST 항원으로 특이적 정제되었습니다. 인간에 반응성이 검증되었으며, 높은 종간 서열 유사성을 가집니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C5orf22 Antibody
Target: chromosome 5 open reading frame 22 (C5orf22)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human C5orf22.
Alternative Gene Names
- FLJ11193
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
IWFHPTWAQQIREGRHHFLVGKDTSTTTIRVTSTDHYFLSDGLYVPEDQLENQKPLQLDVIMVKPYKLCNNQEENDAVSS - Antigen Type: Recombinant protein
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000022745 | 86% |
| Mouse | ENSMUSG00000022195 | 79% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Safety Data | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C5orf15 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C5orf15 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C5orf22 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C5AR2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C4orf50 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.