CacheBy
Atlas Antibodies Anti-C5orf22 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C5orf22 Antibody

상품 한눈에 보기

Atlas Antibodies의 Anti-C5orf22 항체는 인간 C5orf22 단백질을 인식하는 토끼 폴리클로날 IgG 항체입니다. IHC, WB, ICC 등 다양한 응용에 적합하며, PrEST 항원으로 특이적 정제되었습니다. 인간에 반응성이 검증되었으며, 높은 종간 서열 유사성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043062-100 Anti-C5orf22 Antibody, chromosome 5 open reading frame 22 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043062-25 Anti-C5orf22 Antibody, chromosome 5 open reading frame 22 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C5orf22 Antibody

Anti-C5orf22 Antibody

Target: chromosome 5 open reading frame 22 (C5orf22)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human C5orf22.


Alternative Gene Names

  • FLJ11193

Open Datasheet (PDF)


Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    IWFHPTWAQQIREGRHHFLVGKDTSTTTIRVTSTDHYFLSDGLYVPEDQLENQKPLQLDVIMVKPYKLCNNQEENDAVSS
  • Antigen Type: Recombinant protein

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000022745 86%
Mouse ENSMUSG00000022195 79%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Safety Data Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.