CacheBy
Atlas Antibodies Anti-C4orf50 Antibody
원본

Atlas Antibodies Anti-C4orf50 Antibody

상품 한눈에 보기

Human C4orf50 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC 등 다양한 연구 응용에 적합합니다. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공합니다. PBS/글리세롤 완충액에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA058292-100 Anti-C4orf50 Antibody, chromosome 4 open reading frame 50 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058292-25 Anti-C4orf50 Antibody, chromosome 4 open reading frame 50 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C4orf50 Antibody

Anti-C4orf50 Antibody

Target: chromosome 4 open reading frame 50 (C4orf50)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human C4orf50.


Alternative Gene Names

  • FLJ46481

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 4 open reading frame 50
Target Gene C4orf50
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000036737 (32%)
Rat ENSRNOG00000021552 (32%)

Antigen Sequence:
PAQRLQEKGGMPCPALQVDNVPAPSELLSPARILAFHQELRQSICSNSQVHKSPLEL


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application Icon

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.