AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-C4orf46 Antibody
상품 한눈에 보기
Human C4orf46 단백질을 인식하는 폴리클로날 토끼 항체로, IHC 등 다양한 응용에 적합. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공. 인간, 랫, 마우스 종에 반응성이 검증됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA047287-100 Anti-C4orf46 Antibody, chromosome 4 open reading frame 46 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047287-25 Anti-C4orf46 Antibody, chromosome 4 open reading frame 46 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C4orf46 Antibody
Anti-C4orf46 Antibody
Target Information
- Target Protein: Chromosome 4 open reading frame 46
- Target Gene: C4orf46
- Alternative Gene Names: LOC201725, RCDG1
Product Description
Polyclonal antibody against human C4orf46.
Affinity purified using the PrEST antigen as affinity ligand.
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:QVEELAFKCTENARFLKTWRDLLKEGYDSLKPDD
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000010071 (94%)
- Mouse ENSMUSG00000027811 (94%)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Recommended Applications | Immunohistochemistry (IHC) |
| Safety Data Sheet | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.