Atlas Antibodies Anti-C4orf46 Antibody
| 상품 옵션 정보 | ||||||||
|---|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA047287-100 | - | Atlas Antibodies HPA047287-100 Anti-C4orf46 Antibody, chromosome 4 open reading frame 46 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
| HPA047287-25 | - | Atlas Antibodies HPA047287-25 Anti-C4orf46 Antibody, chromosome 4 open reading frame 46 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 | |
다른 상품 둘러보기
Anti-C4orf46 Antibody
chromosome 4 open reading frame 46
Recommended Applications
Product Description
Polyclonal Antibody against Human C4orf46
Alternative Gene Names
LOC201725, RCDG1
Target Protein
chromosome 4 open reading frame 46
Target Gene
C4orf46
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
QVEELAFKCTENARFLKTWRDLLKEGYDSLKPDD
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Rat ENSRNOG00000010071 (94%)
Mouse ENSMUSG00000027811 (94%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|