
Atlas Antibodies Anti-C4orf46 Antibody
상품 한눈에 보기
Human C4orf46 단백질을 인식하는 폴리클로날 토끼 항체로, IHC 등 다양한 응용에 적합. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공. 인간, 랫, 마우스 종에 반응성이 검증됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C4orf46 Antibody
Target Information
- Target Protein: Chromosome 4 open reading frame 46
- Target Gene: C4orf46
- Alternative Gene Names: LOC201725, RCDG1
Product Description
Polyclonal antibody against human C4orf46.
Affinity purified using the PrEST antigen as affinity ligand.
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:QVEELAFKCTENARFLKTWRDLLKEGYDSLKPDD
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000010071 (94%)
- Mouse ENSMUSG00000027811 (94%)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Recommended Applications | Immunohistochemistry (IHC) |
| Safety Data Sheet | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C4orf48 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C4orf47 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C4orf46 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C4orf36 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C4orf47 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.