CacheBy
Atlas Antibodies Anti-C4orf47 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C4orf47 Antibody

상품 한눈에 보기

인간 C4orf47 단백질을 인식하는 rabbit polyclonal 항체로, IHC 등 연구용으로 적합합니다. PrEST 항원으로 면역화되어 높은 특이성과 재현성을 제공합니다. 친화 정제 방식으로 높은 순도를 유지하며, PBS/glycerol buffer에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA063485-100 Anti-C4orf47 Antibody, chromosome 4 open reading frame 47 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063485-25 Anti-C4orf47 Antibody, chromosome 4 open reading frame 47 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C4orf47 Antibody

Anti-C4orf47 Antibody

Target: chromosome 4 open reading frame 47 (C4orf47)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human C4orf47.


Alternative Gene Names

  • LOC441054

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 4 open reading frame 47
Target Gene C4orf47
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence ITVGDKYVSQFNRPFNEAASKNKQMLPGGSKEMSDLQAGYFDPHFVRIFEGEGYINLNQVRRRDMVEAAKKNLGKAFLPSN

Species Reactivity

  • Verified: Human
  • Interspecies Homology:
    • Rat ENSRNOG00000038819 (81%)
    • Mouse ENSMUSG00000071103 (80%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.