
Atlas Antibodies Anti-C2orf70 Antibody
상품 한눈에 보기
Human C2orf70 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC에 권장됩니다. Orthogonal validation을 통해 RNA-seq 데이터와 단백질 발현 비교 검증이 수행되었습니다. Affinity purification 방식으로 정제되었으며, PBS/glycerol buffer에 보존됩니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C2orf70 Antibody
Target: chromosome 2 open reading frame 70 (C2orf70)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): 단백질 발현을 RNA-seq 데이터와 비교하여 고·저발현 조직 간의 발현을 검증함
- ICC
Product Description
Polyclonal antibody against human C2orf70.
Alternative Gene Names
- LOC339778
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 2 open reading frame 70 |
| Target Gene | C2orf70 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | SAGTLLTEFNAAYVPPGLMPGYQGHVPTVAFSFGAPYGTTTLKYFQDHRNRAMEKSHTPFSQGG |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000029182 (69%), Rat ENSRNOG00000009905 (66%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 맞는 최적의 농도 및 조건은 사용자가 직접 결정해야 합니다.
Additional Information
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C2orf73 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C2orf72 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C2orf70 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C2orf71 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C2orf69 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.