CacheBy
Atlas Antibodies Anti-C2orf71 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C2orf71 Antibody

상품 한눈에 보기

Human C2orf71 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 연구 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 대해 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051819-100 Anti-C2orf71 Antibody, chromosome 2 open reading frame 71 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051819-25 Anti-C2orf71 Antibody, chromosome 2 open reading frame 71 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C2orf71 Antibody

Anti-C2orf71 Antibody

Target: chromosome 2 open reading frame 71 (C2orf71)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human C2orf71, designed for research applications such as immunohistochemistry (IHC).


Alternative Gene Names

  • FLJ34931
  • RP54

Target Information

  • Target Protein: chromosome 2 open reading frame 71
  • Target Gene: C2orf71

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

HSDLVNSVAKSGIQFLKKPKAIRPGCQGGSERGSIPLLVKNSTCYDAGEGLAEEQPSPRRNQTTAKGLCQLMGDPASGKRKDMEGLIPGTKTSSS

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Mouse ENSMUSG00000044375 50%
Rat ENSRNOG00000008942 42%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)

  • Immunohistochemistry (IHC)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Open Datasheet (PDF)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.