CacheBy
Thermo Fisher Scientific Human IL-6, Animal-Free Recombinant Protein, PeproTech
원본

Thermo Fisher Scientific Human IL-6, Animal-Free Recombinant Protein, PeproTech

상품 한눈에 보기

인간 IL-6 재조합 단백질로, 동물 유래 성분이 없는 E. coli 발현 제품입니다. 염증 반응 및 B 세포 성숙 연구에 활용되며, ≥98% 순도를 보장합니다. 마우스 B9 세포 증식 활성으로 기능 검증 완료. 상온 배송, -20°C 보관.

카테고리
Protein
판매단위
pk
카탈로그 보기

카탈로그

4개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
장비
Thermo Fisher Scientific AF-200-06-1MG Human IL-6, Animal-Free Recombinant Protein, PeproTech 1 mg pk판매 단위 pk
재고 1개
5,325,500원VAT 포함 5,858,050원
Thermo Fisher Scientific AF-200-06-500UG Human IL-6, Animal-Free Recombinant Protein, PeproTech 500 ug pk판매 단위 pk
재고 1개
3,252,200원VAT 포함 3,577,420원
소모품
Thermo Fisher Scientific AF-200-06-100UG Human IL-6, Animal-Free Recombinant Protein, PeproTech 100 ug pk판매 단위 pk
재고 1개
1,234,600원VAT 포함 1,358,060원
Thermo Fisher Scientific AF-200-06-20UG Human IL-6, Animal-Free Recombinant Protein, PeproTech 20 ug pk판매 단위 pk
재고 1개
359,800원VAT 포함 395,780원

Thermo Fisher Scientific · Thermo Fisher Scientific Human IL-6, Animal-Free Recombinant Protein, PeproTech

Applications

ELISA (ELISA)

Functional Assay (Functional)

In vitro Assay (IV)


Product Specifications

항목 내용
Species Human
Published Species Human, Mouse
Expression System E. coli
Amino Acid Sequence PVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Molecular Weight 20.9 kDa
Class Recombinant
Type Protein
Purity ≥ 98% (by SDS-PAGE and HPLC)
Endotoxin Concentration < 0.1 EU/µg
Activity Stimulates proliferation of mouse B9 cells
Conjugate Unconjugated
Form Lyophilized
Purification Purified
Contains No preservative
Storage Conditions -20°C
Shipping Conditions Ambient

Product Specific Information

Recombinant Human IL-6 is a 20.9 kDa protein containing 184 amino acid residues.
This product is shipped at ambient temperature.
For storage, handling, and reconstitution information, please refer to the lot-specific Certificate of Analysis.


Target Information

IL-6 encodes a cytokine involved in inflammation and B cell maturation.
This endogenous pyrogen can induce fever in autoimmune diseases or infections.
It is primarily expressed at sites of acute and chronic inflammation, secreted into serum, and induces transcriptional inflammatory responses via the interleukin 6 receptor alpha.
IL-6 function is implicated in inflammation-associated diseases such as diabetes mellitus and systemic juvenile rheumatoid arthritis.
Elevated IL-6 levels have been observed in viral infections, including COVID-19 (SARS-CoV-2).
Associated diseases include Kaposi Sarcoma and Rheumatoid Arthritis (Systemic Juvenile).


For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.