
Thermo Fisher Scientific Human IL-6, Animal-Free Recombinant Protein, PeproTech
인간 IL-6 재조합 단백질로, 동물 유래 성분이 없는 E. coli 발현 제품입니다. 염증 반응 및 B 세포 성숙 연구에 활용되며, ≥98% 순도를 보장합니다. 마우스 B9 세포 증식 활성으로 기능 검증 완료. 상온 배송, -20°C 보관.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
ELISA (ELISA)
- Tested Dilution: Not specified
- Publications: View 1 publication
Functional Assay (Functional)
- Assay-dependent
- Publications: View reference
In vitro Assay (IV)
- Tested Dilution: Not specified
- Publications: View 62 publications
Product Specifications
| 항목 | 내용 |
|---|---|
| Species | Human |
| Published Species | Human, Mouse |
| Expression System | E. coli |
| Amino Acid Sequence | PVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
| Molecular Weight | 20.9 kDa |
| Class | Recombinant |
| Type | Protein |
| Purity | ≥ 98% (by SDS-PAGE and HPLC) |
| Endotoxin Concentration | < 0.1 EU/µg |
| Activity | Stimulates proliferation of mouse B9 cells |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Purification | Purified |
| Contains | No preservative |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient |
Product Specific Information
Recombinant Human IL-6 is a 20.9 kDa protein containing 184 amino acid residues.
This product is shipped at ambient temperature.
For storage, handling, and reconstitution information, please refer to the lot-specific Certificate of Analysis.
Target Information
IL-6 encodes a cytokine involved in inflammation and B cell maturation.
This endogenous pyrogen can induce fever in autoimmune diseases or infections.
It is primarily expressed at sites of acute and chronic inflammation, secreted into serum, and induces transcriptional inflammatory responses via the interleukin 6 receptor alpha.
IL-6 function is implicated in inflammation-associated diseases such as diabetes mellitus and systemic juvenile rheumatoid arthritis.
Elevated IL-6 levels have been observed in viral infections, including COVID-19 (SARS-CoV-2).
Associated diseases include Kaposi Sarcoma and Rheumatoid Arthritis (Systemic Juvenile).
For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific Human IL-7, Animal-Free Recombinant Protein, PeproTech
169,200원

Thermo Fisher Scientific
Thermo Fisher Scientific Human IL-7, Animal-Free Recombinant Protein, PeproTech
359,800원

Thermo Fisher Scientific
Thermo Fisher Scientific Human IL-6, Animal-Free Recombinant Protein, PeproTech
359,800원

Thermo Fisher Scientific
Thermo Fisher Scientific Human IL-6, Animal-Free Recombinant Protein, PeproTech
169,200원

Thermo Fisher Scientific
Thermo Fisher Scientific Human IL-5, Animal-Free Recombinant Protein, PeproTech
170,100원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|