Thermo Fisher Scientific Calretinin Polyclonal Antibody, Biotin
Calretinin 단백질을 인식하는 Biotin 결합 토끼 다클론 항체로, Western blot, IHC, ICC, ELISA 등 다양한 응용에 적합합니다. 사람, 마우스, 랫트 반응성이 있으며, 고순도 친화 크로마토그래피로 정제되었습니다. 연구용으로만 사용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:500–1:1,000 |
| Immunohistochemistry (IHC) | 1:50–1:250 |
| Immunocytochemistry (ICC/IF) | 1:50–1:250 |
| ELISA | 1:10,000 |
| Immunoprecipitation (IP) | 1:100–1:250 |
| Dot Blot (DB) | 1:10,000 |
| Immunomicroscopy (IM) | 1:50–1:200 |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Conjugate | Biotin |
| Form | Liquid |
| Concentration | 0.5–1.5 mg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | Proprietary buffer (pH 7.4–7.8) with 30% glycerol, 0.5% BSA |
| Contains | 0.02% sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
Immunogen Information
Synthetic peptide within amino acid region 220–271 of Calretinin, conjugated to Keyhole Limpet Hemocyanin (KLH).
Peptide sequence: LDALLKDLYEKNKKEMNIQQLTNYRKSVMSLAEGKLYRKDLEIVLCSEPPLM
Target Information
Calretinin is encoded by the CALB2 gene located on chromosome 16. It belongs to the troponin C superfamily and contains six EF-hand motifs that bind calcium. This protein plays a role in calcium signaling, buffering, and modulation of neuronal excitability. Calretinin is expressed in the mesothelium, mast cells, certain neural cells, hair follicles, and fat cells.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific Calretinin Polyclonal Antibody
449,700원
Thermo Fisher Scientific
Thermo Fisher Scientific Calretinin Polyclonal Antibody, FITC
594,400원
Thermo Fisher Scientific
Thermo Fisher Scientific Calretinin Polyclonal Antibody, Biotin
594,400원
Thermo Fisher Scientific
Thermo Fisher Scientific Calretinin Polyclonal Antibody
449,700원
Thermo Fisher Scientific
Thermo Fisher Scientific Cadherin 74A Polyclonal Antibody, FITC
594,400원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|