
원본
Thermo Fisher Scientific Calretinin Polyclonal Antibody, FITC
상품 한눈에 보기
FITC로 표지된 Calretinin 폴리클로날 항체로, 인간, 마우스, 랫트 시료에 반응합니다. WB, IHC, ICC, ELISA 등 다양한 응용에 사용 가능하며, 액상 형태로 제공됩니다. 친화 크로마토그래피로 정제되었으며, -20°C에서 암소 보관합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific CAL-101-FITC Calretinin Polyclonal Antibody, FITC 200 ul pk판매 단위 pk
594,400원VAT 포함 653,840원
Thermo Fisher Scientific · Thermo Fisher Scientific Calretinin Polyclonal Antibody, FITC
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:500–1:1,000 |
| Immunohistochemistry (IHC) | 1:50–1:250 |
| Immunocytochemistry (ICC/IF) | 1:50–1:250 |
| ELISA | 1:10,000 |
| Immunoprecipitation (IP) | 1:100–1:250 |
| Dot blot (DB) | 1:10,000 |
| Immunomicroscopy (IM) | 1:50–1:200 |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide within amino acid region 220–271, conjugated to Keyhole Limpet Hemocyanin (KLH). Peptide was covalently modified. Sequence: LDALLKDLYEKNKKEMNIQQLTNYRKSVMSLAEGKLYRKDLEIVLCSEP |
| Conjugate | FITC |
| Excitation / Emission Max | 498 / 517 nm |
| Form | Liquid |
| Concentration | 0.5–1.5 mg/mL |
| Purification | Affinity chromatography |
| Storage buffer | Proprietary buffer (pH 7.4–7.8) containing 0.5% BSA, 30% glycerol |
| Contains | 0.02% sodium azide |
| Storage conditions | -20°C, store in dark |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
Target Information
Calretinin은 CALB2 유전자에 의해 암호화되며, 염색체 16번에 위치합니다. 이 단백질은 여섯 개의 EF-hand 구조 모티프를 가진 트로포닌 C 슈퍼패밀리 단백질로, 칼슘 결합 및 신호 전달, 칼슘 완충, 신경 흥분성 조절에 관여합니다. Calretinin은 중피세포, 비만세포, 일부 신경세포, 모낭, 지방세포 등에서 발현됩니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지

Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
