Thermo Fisher Scientific SLC7A5 Polyclonal Antibody
SLC7A5 단백질을 인식하는 Thermo Fisher Scientific의 토끼 폴리클로날 항체. Western blot, ICC/IF, ELISA에 사용 가능. 인간, 생쥐, 랫트 반응성. 고순도 친화 크로마토그래피 정제, PBS/glycerol 저장용액. 연구용으로만 사용.
- 카탈로그번호
- PA591842
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific SLC7A5 Polyclonal Antibody
Thermo Fisher Scientific SLC7A5 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:500–1:1,000 |
| Immunocytochemistry (ICC/IF) | 1:100–1:500 |
| ELISA | 1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant fusion protein containing amino acids 1–125 of human LAT1/SLC7A5 (NP_003477.4) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.93 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS, pH 7.3, with 50% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2806302 |
Product Specific Information
- Immunogen sequence: MAGAGPKRRALAAPAAEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNITLLNGVAIIVGTIIGSGIFVTPTGVLKEAGSPGLALVVWAACGVFSIVGALCYAELGTTISKSGGDYAYMLEVYG
- Positive Samples: A-549, MCF7, SW480, HeLa, HepG2, Mouse brain, Rat liver
- Cellular Location: Apical cell membrane, Cytoplasm, Multi-pass membrane protein, Cytosol
Target Information
Solute carrier family 7 member 5 (SLC7A5), also known as large neutral amino acids transporter small subunit 1, is encoded by the SLC7A5 gene in humans.
It mediates sodium-independent, high-affinity transport of large neutral amino acids such as phenylalanine, tyrosine, leucine, arginine, and tryptophan when associated with SLC3A2/4F2hc.
This transporter is involved in cellular amino acid uptake and the transport of L-DOPA and thyroid hormones (T3, T4) across cell membranes in tissues including the placenta.
SLC7A5 acts as an amino acid exchanger and contributes to neuronal cell proliferation (neurogenesis) in the brain.
For Research Use Only. Not for use in diagnostic procedures or resale without authorization.
제품 이미지
(이미지 없음)
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.