Thermo Fisher Scientific SLC7A5 Polyclonal Antibody
SLC7A5 단백질을 인식하는 Thermo Fisher Scientific의 토끼 폴리클로날 항체. Western blot, ICC/IF, ELISA에 사용 가능. 인간, 생쥐, 랫트 반응성. 고순도 친화 크로마토그래피 정제, PBS/glycerol 저장용액. 연구용으로만 사용.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Thermo Fisher Scientific SLC7A5 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:500–1:1,000 |
| Immunocytochemistry (ICC/IF) | 1:100–1:500 |
| ELISA | 1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant fusion protein containing amino acids 1–125 of human LAT1/SLC7A5 (NP_003477.4) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.93 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS, pH 7.3, with 50% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2806302 |
Product Specific Information
- Immunogen sequence: MAGAGPKRRALAAPAAEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNITLLNGVAIIVGTIIGSGIFVTPTGVLKEAGSPGLALVVWAACGVFSIVGALCYAELGTTISKSGGDYAYMLEVYG
- Positive Samples: A-549, MCF7, SW480, HeLa, HepG2, Mouse brain, Rat liver
- Cellular Location: Apical cell membrane, Cytoplasm, Multi-pass membrane protein, Cytosol
Target Information
Solute carrier family 7 member 5 (SLC7A5), also known as large neutral amino acids transporter small subunit 1, is encoded by the SLC7A5 gene in humans.
It mediates sodium-independent, high-affinity transport of large neutral amino acids such as phenylalanine, tyrosine, leucine, arginine, and tryptophan when associated with SLC3A2/4F2hc.
This transporter is involved in cellular amino acid uptake and the transport of L-DOPA and thyroid hormones (T3, T4) across cell membranes in tissues including the placenta.
SLC7A5 acts as an amino acid exchanger and contributes to neuronal cell proliferation (neurogenesis) in the brain.
For Research Use Only. Not for use in diagnostic procedures or resale without authorization.
제품 이미지
(이미지 없음)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific Cdc2L6 Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific ALX4 Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific SLC7A5 Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific RhoB Polyclonal Antibody
618,800원
Thermo Fisher Scientific
Thermo Fisher Scientific TSFM Polyclonal Antibody
618,800원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|