CacheBy
Atlas Antibodies Anti-PPCDC Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PPCDC Antibody

상품 한눈에 보기

인간 PPCDC 단백질을 표적으로 하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 재조합 단백질을 이용한 검증 완료. 토끼 유래 IgG 항체이며 PrEST 항원을 이용해 친화 정제되었습니다. 인간에 높은 특이성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA045667-100 Anti-PPCDC Antibody, phosphopantothenoylcysteine decarboxylase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045667-25 Anti-PPCDC Antibody, phosphopantothenoylcysteine decarboxylase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PPCDC Antibody

Anti-PPCDC Antibody

phosphopantothenoylcysteine decarboxylase


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Recombinant Expression validation)
  • ICC (Immunocytochemistry)

Recombinant expression validation in WB using target protein overexpression.


Product Description

Polyclonal Antibody against Human PPCDC


Alternative Gene Names

FLJ14585, MDS018

Open Datasheet


Target Information

항목 내용
Target Protein phosphopantothenoylcysteine decarboxylase
Target Gene PPCDC
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence LLVAPLDANTLGKVASGICDNLLTCVMRAWDRSKPLLFCPAMNTAMWEHPITAQQVDQLKAFGYVEIPCVAKKLVCGDEGLGAMAEVGTIV

Verified Species Reactivity

Human


Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000063849 (90%)
  • Rat ENSRNOG00000053404 (88%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.