Atlas Antibodies Anti-PPCS Antibody

상품 한눈에 보기

Human PPCS 단백질을 인식하는 rabbit polyclonal 항체로, IHC, WB, ICC에 적합. PrEST 항원을 이용한 affinity purification으로 높은 특이성과 재현성 확보. Human에 검증된 반응성을 보유하며 독립 항체 비교를 통한 검증 완료.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA031363-100 Anti-PPCS Antibody, phosphopantothenoylcysteine synthetase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA031363-25 Anti-PPCS Antibody, phosphopantothenoylcysteine synthetase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-PPCS Antibody

Anti-PPCS Antibody

Target: phosphopantothenoylcysteine synthetase
Type: Polyclonal Antibody against Human PPCS
Supplier: Atlas Antibodies

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB, Independent validation)
Immunocytochemistry (ICC)

Validation Note:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal antibody targeting human PPCS, purified using PrEST antigen affinity chromatography.

Alternative Gene Names

FLJ11838

Target Information

항목	내용
Target Protein	phosphopantothenoylcysteine synthetase
Target Gene	PPCS
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse (93%), Rat (92%)

Antigen Sequence:

VLFLYRARSAFPYAHRFPPQTWLSALRPSGPALSGLLSLEAEENALPGFAEALRSYQEAAAAGTFLAVEFTTLADY

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.