
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-POU3F4 Antibody
상품 한눈에 보기
인간 POU3F4 단백질을 표적으로 하는 토끼 유래 폴리클로날 항체. 웨스턴 블롯 등 다양한 연구 응용에 적합. 고순도 Affinity 정제 방식으로 제조. 인간에 높은 특이성과 반응성 보유.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA062295-100 Anti-POU3F4 Antibody, POU class 3 homeobox 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062295-25 Anti-POU3F4 Antibody, POU class 3 homeobox 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-POU3F4 Antibody
Anti-POU3F4 Antibody
Target Information
- Protein: POU class 3 homeobox 4
- Gene: POU3F4
- Alternative Gene Names: BRN4, DFN3, DFNX2, OTF9
Recommended Applications
웨스턴 블롯 (WB)
Product Description
Polyclonal antibody against Human POU3F4.
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
RSPHVAHHSPHTNHPNAWGASPAPNPSITSSGQPLNVYSQPGFTVSGMLEHGGLTPPPAAASAQSLHPVLREPPDHGELGSHHCQDH
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000002784 (98%)
- Mouse ENSMUSG00000056854 (98%)
Technical Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Species Reactivity | Human |
| Applications | Western blot and other immunoassays |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



