CacheBy
Atlas Antibodies Anti-POU3F4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-POU3F4 Antibody

상품 한눈에 보기

인간 POU3F4 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. Western blot 등 다양한 응용 가능. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공. BRN4, DFN3 등 다양한 대체 유전자명으로도 사용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA031984-100 Anti-POU3F4 Antibody, POU class 3 homeobox 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031984-25 Anti-POU3F4 Antibody, POU class 3 homeobox 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-POU3F4 Antibody

Anti-POU3F4 Antibody

Target Information

  • Target Protein: POU class 3 homeobox 4
  • Target Gene: POU3F4
  • Alternative Gene Names: BRN4, DFN3, DFNX2, OTF9

Product Description

Polyclonal antibody against human POU3F4.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

RSPHVAHHSPHTNHPNAWGASPAPNPSITSSGQPLNVYSQPGFTVSGMLEHGGLTPPPAAASAQSLHPVLREPPDHGELGSHHCQDH

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000056854 (98%)
  • Rat ENSRNOG00000002784 (98%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Western Blot (WB)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.