
1 / 2
Atlas Antibodies Anti-POT1 Antibody
상품 한눈에 보기
인간 POT1 단백질을 인식하는 폴리클로날 항체로, 텔로미어 보호 단백질 연구에 적합합니다. 토끼 유래 IgG이며, PrEST 항원을 이용해 친화 정제되었습니다. ICC 등 다양한 응용에 사용 가능합니다. 글리세롤 및 PBS 완충액에 보존되어 있습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-POT1 Antibody
Target Protein: protection of telomeres 1 (POT1)
Supplier: Atlas Antibodies
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human POT1 protein.
Alternative Gene Names
- DKFZp586D211
- hPot1
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
LTFEGTLGAPIIPRTSSKYFNFTTEDHKMVEALRVWASTHMSPSWTLLKLCDVQPMQYFDLTCQLLGKAEVDGASFLLKVWDGTR
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000098835 | 76% |
| Rat | ENSRNOG00000019986 | 74% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide (preservative)
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PORCN Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POU1F1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POT1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POTEE Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POU2F1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.