CacheBy
Atlas Antibodies Anti-PORCN Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PORCN Antibody

상품 한눈에 보기

Human PORCN 단백질을 인식하는 토끼 폴리클로날 항체로, 정제된 PrEST 항원을 사용하여 제작되었습니다. IHC를 통한 단백질 발현의 정교한 Orthogonal 검증에 적합하며, 높은 종간 보존성을 보입니다. PBS/glycerol 완충액에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA058413-100 Anti-PORCN Antibody, porcupine homolog (Drosophila) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058413-25 Anti-PORCN Antibody, porcupine homolog (Drosophila) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PORCN Antibody

Anti-PORCN Antibody

porcupine homolog (Drosophila)


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human PORCN


Alternative Gene Names

DHOF, MG61, por, PORC, PPN

Open Datasheet


Target Information

항목 내용
Target Protein porcupine homolog (Drosophila)
Target Gene PORCN
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence AVSFHFSNYFVGFLSEATATLAGAGFTEEKDHLEWDLTVSKPLNVELPRSMVEVVTSWNLPMSYWLNNYVFKNAL
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000031169 (99%), Rat ENSRNOG00000004819 (99%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.