
Atlas Antibodies Anti-POLR3E Antibody
상품 한눈에 보기
Human POLR3E 단백질을 표적으로 하는 토끼 폴리클로날 항체. WB 및 ICC에 적합하며, PrEST 항원으로 친화 정제됨. 높은 종간 보존성과 검증된 특이성을 제공. 40% 글리세롤 및 PBS 완충액에 보존됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-POLR3E Antibody
Target: polymerase (RNA) III (DNA directed) polypeptide E (80kD)
Supplier: Atlas Antibodies
Recommended Applications
- WB (Western Blot): Validation of protein expression by comparing independent antibodies targeting different epitopes.
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human POLR3E.
Alternative Gene Names
FLJ10509, RPC5, SIN
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | polymerase (RNA) III (DNA directed) polypeptide E (80kD) |
| Target Gene | POLR3E |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | VRPASMTYDDIPHLSAKIKPKQQKVELEMAIDTLNPNYCRSKGEQIALNVDGACADETSTYSSKLMDKQTFCSSQTTSNTSRYAAALYRQGELHLTPLHGILQLRPSFSYLDK |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000030880 | 99% |
| Rat | ENSRNOG00000016960 | 98% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-POLR3F Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POLR3G Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POLR3E Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POLR3D Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-POLR3D Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.