CacheBy
Atlas Antibodies Anti-POLR3D Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-POLR3D Antibody

상품 한눈에 보기

Human POLR3D 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 종 간 보존성을 보입니다. 40% 글리세롤 및 PBS 완충액에 보존되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA069089-100 Anti-POLR3D Antibody, polymerase (RNA) III (DNA directed) polypeptide D, 44kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA069089-25 Anti-POLR3D Antibody, polymerase (RNA) III (DNA directed) polypeptide D, 44kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-POLR3D Antibody

Anti-POLR3D Antibody

Target: polymerase (RNA) III (DNA directed) polypeptide D, 44kDa
Supplier: Atlas Antibodies


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human POLR3D.


Alternative Gene Names

BN51T, RPC4, TSBN51

Open Datasheet (PDF)


Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:

DRQREGHGRGRGRPEVIQSHSIFEQGPAEMMKKKGNWDKTVDVSDMGPSHIINIKKEKRETDEE

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000000776 98%
Rat ENSRNOG00000010028 98%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

WB Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.