
Atlas Antibodies Anti-PNP Antibody
상품 한눈에 보기
Human PNP 단백질을 인식하는 고품질 Rabbit Polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증된 신뢰성 높은 제품입니다. Affinity purification으로 높은 특이성과 재현성을 제공합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PNP Antibody
Target: Purine nucleoside phosphorylase (PNP)
Type: Rabbit Polyclonal Antibody
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): Protein expression verified by comparison to RNA-seq data of target in high and low expression tissues.
- WB (Orthogonal validation): Protein expression verified by comparison to RNA-seq data of target in high and low expression cell lines.
- ICC: Suitable for immunocytochemistry applications.
Product Description
Polyclonal Antibody against Human PNP
Alternative Gene Names: NP, PUNP
Target Protein: Purine nucleoside phosphorylase
Target Gene: PNP
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
YTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERGAPHR
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information
| Species | Ortholog ID | Identity (%) |
|---|---|---|
| Rat | ENSRNOG00000009982 | 87% |
| Mouse | ENSMUSG00000021871 | 83% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| Component | Concentration / Description |
|---|---|
| Glycerol | 40% |
| PBS | pH 7.2 |
| Sodium Azide | 0.02% (preservative) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PNPLA5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PNPLA2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PNP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PNPLA2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PNMT Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.