
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PNPLA2 Antibody
상품 한눈에 보기
Human PNPLA2 단백질을 인식하는 Rabbit Polyclonal 항체로, patatin-like phospholipase domain containing 2를 타깃으로 함. ICC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. Human에 반응하며, Mouse 및 Rat과 91% 서열 유사성을 가짐.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA055173-100 Anti-PNPLA2 Antibody, patatin-like phospholipase domain containing 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055173-25 Anti-PNPLA2 Antibody, patatin-like phospholipase domain containing 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PNPLA2 Antibody
Anti-PNPLA2 Antibody
Target Protein: patatin-like phospholipase domain containing 2 (PNPLA2)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human PNPLA2 (patatin-like phospholipase domain containing 2).
Alternative Gene Names
ATGL, desnutrin, FP17548, iPLA2zeta, TTS-2.2
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
SICQYLVMRAKRKLGRHLPSRLPEQVELRRVQSLPSVPLSCAAYREALPGWMRNNLSLGDALAKWEECQRQLLLGLFCTNVAFPPEALRMRA
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000047551 | 91% |
| Mouse | ENSMUSG00000025509 | 91% |
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



