
Atlas Antibodies Anti-PNPLA2 Antibody
상품 한눈에 보기
Human PNPLA2 단백질을 인식하는 Rabbit Polyclonal 항체로, patatin-like phospholipase domain containing 2를 타깃으로 함. ICC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. Human에 반응하며, Mouse 및 Rat과 91% 서열 유사성을 가짐.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PNPLA2 Antibody
Target Protein: patatin-like phospholipase domain containing 2 (PNPLA2)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human PNPLA2 (patatin-like phospholipase domain containing 2).
Alternative Gene Names
ATGL, desnutrin, FP17548, iPLA2zeta, TTS-2.2
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
SICQYLVMRAKRKLGRHLPSRLPEQVELRRVQSLPSVPLSCAAYREALPGWMRNNLSLGDALAKWEECQRQLLLGLFCTNVAFPPEALRMRA
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000047551 | 91% |
| Mouse | ENSMUSG00000025509 | 91% |
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
