
Atlas Antibodies Anti-PNLIP Antibody
Human PNLIP 단백질을 인식하는 토끼 폴리클로날 항체로, pancreatic lipase 연구용에 적합. IHC Orthogonal 검증 완료. PrEST 항원으로 친화 정제되었으며, 높은 특이성과 재현성을 제공. Human에 반응하며 Mouse, Rat과도 높은 상동성 보유.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PNLIP Antibody
Target: Pancreatic lipase (PNLIP)
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human PNLIP.
Alternative Gene Names
PL
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Pancreatic lipase |
| Target Gene | PNLIP |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | PTLPRVGASKIIVETNVGKQFNFCSPETVR |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000046008 (73%) Rat ENSRNOG00000017725 (70%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PNKP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PNLIP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PNLIP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PNLDC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PNISR Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|