CacheBy
Atlas Antibodies Anti-PNLIP Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PNLIP Antibody

상품 한눈에 보기

휴먼 PNLIP를 타깃으로 하는 폴리클로날 항체로, 췌장 리파아제 단백질 검출에 적합합니다. IHC 정량 검증 및 RNA-seq 데이터 기반 교차 검증 수행. 토끼 유래 IgG 항체로, Affinity purification 방식으로 정제되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA062494-100 Anti-PNLIP Antibody, pancreatic lipase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062494-25 Anti-PNLIP Antibody, pancreatic lipase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PNLIP Antibody

Anti-PNLIP Antibody

Target: Pancreatic lipase (PNLIP)
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against human PNLIP.

Alternative Gene Names

PL

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Pancreatic lipase
Target Gene PNLIP
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence PTLPRVGASKIIVETNVGKQFNFCSPETVR
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000046008 (73%), Rat ENSRNOG00000017725 (70%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.