
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PMS2 Antibody
상품 한눈에 보기
인간 PMS2 단백질을 인식하는 토끼 폴리클로날 항체로, DNA 불일치 복구 시스템 연구에 적합. Affinity 정제 방식으로 높은 특이성과 재현성 제공. 면역형광(ICC) 등 다양한 응용에 사용 가능. 글리세롤 기반 안정화 버퍼 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA066490-100 Anti-PMS2 Antibody, PMS1 homolog 2, mismatch repair system component 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA066490-25 Anti-PMS2 Antibody, PMS1 homolog 2, mismatch repair system component 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PMS2 Antibody
Anti-PMS2 Antibody
Target: PMS1 homolog 2, mismatch repair system component (PMS2)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human PMS2 protein, a key component of the DNA mismatch repair system.
Recommended Applications
- Immunocytochemistry (ICC)
Alternative Gene Names
HNPCC4, H_DJ0042M02.9, MLH4, PMSL2
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
AISDKGVLRPQKEAVSSSQGPSDPTDRAEVEKDSGHGSTSVDSEGFSIPDTGSHCSSEC
Verified Species Reactivity
- Human
Interspecies Information:
Highest antigen sequence identity observed with:
- Rat (ENSRNOG00000001040) – 47%
- Mouse (ENSMUSG00000079109) – 45%
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (Sodium Azide)
Notes
- Use gentle mixing before application.
- Optimal concentrations and conditions should be determined experimentally by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



