
Atlas Antibodies Anti-PMS2 Antibody
상품 한눈에 보기
인간 PMS2 단백질을 인식하는 토끼 폴리클로날 항체로, DNA 불일치 복구 시스템 연구에 적합. Affinity 정제 방식으로 높은 특이성과 재현성 제공. 면역형광(ICC) 등 다양한 응용에 사용 가능. 글리세롤 기반 안정화 버퍼 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PMS2 Antibody
Target: PMS1 homolog 2, mismatch repair system component (PMS2)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human PMS2 protein, a key component of the DNA mismatch repair system.
Recommended Applications
- Immunocytochemistry (ICC)
Alternative Gene Names
HNPCC4, H_DJ0042M02.9, MLH4, PMSL2
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
AISDKGVLRPQKEAVSSSQGPSDPTDRAEVEKDSGHGSTSVDSEGFSIPDTGSHCSSEC
Verified Species Reactivity
- Human
Interspecies Information:
Highest antigen sequence identity observed with:
- Rat (ENSRNOG00000001040) – 47%
- Mouse (ENSMUSG00000079109) – 45%
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (Sodium Azide)
Notes
- Use gentle mixing before application.
- Optimal concentrations and conditions should be determined experimentally by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
