CacheBy
Atlas Antibodies Anti-PMPCB Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PMPCB Antibody

상품 한눈에 보기

Human PMPCB 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. 인체 미토콘드리아 처리 펩티다아제 베타 단백질 연구용에 적합합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040674-100 Anti-PMPCB Antibody, peptidase (mitochondrial processing) beta 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040674-25 Anti-PMPCB Antibody, peptidase (mitochondrial processing) beta 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PMPCB Antibody

Anti-PMPCB Antibody

Target: Peptidase (mitochondrial processing) beta
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human PMPCB protein.


Alternative Gene Names

MPPB, MPPP52

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Peptidase (mitochondrial processing) beta
Target Gene PMPCB
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence WGFSESLLIRGAAGRSLYFGENRLRSTQAATQVVLNVPETRVTCLESGLRVASEDSGLSTCTVGLWIDAG
Verified Species Reactivity Human
Interspecies Identity Mouse (79%), Rat (77%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.