
Atlas Antibodies Anti-PLRG1 Antibody
Human PLRG1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 특이적으로 정제되었으며, 독립적 항체 검증을 통해 신뢰도 높은 단백질 발현 확인이 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PLRG1 Antibody
Target: pleiotropic regulator 1 (PLRG1)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Independent validation)
- Immunocytochemistry (ICC)
Validation Note:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against human PLRG1.
Alternative Gene Names
Cwc1, PRL1, Prp46, PRPF46, TANGO4
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
GPGVALTADTKIQRMPSESAAQSLAVALPLQTKADANRTAPSGSEYRHPGASDRPQPTAMNSIVMETGNTKNSALMAKKAPTMPKPQWH
Verified Species Reactivity
- Human
Interspecies Information:
Highest antigen sequence identity to orthologs:
- Mouse ENSMUSG00000027998 (92%)
- Rat ENSRNOG00000006655 (91%)
Technical Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PLS1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PLRG1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PLRG1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PLRG1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PLPPR5 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|