CacheBy
Atlas Antibodies Anti-PLRG1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PLRG1 Antibody

상품 한눈에 보기

Human PLRG1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 보입니다. 연구용으로 단백질 발현 검증에 활용됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA061486-100 Anti-PLRG1 Antibody, pleiotropic regulator 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061486-25 Anti-PLRG1 Antibody, pleiotropic regulator 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PLRG1 Antibody

Anti-PLRG1 Antibody

Target: pleiotropic regulator 1 (PLRG1)
Supplier: Atlas Antibodies

  • IHC (Immunohistochemistry)
  • WB (Western Blot) — Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human PLRG1.

Alternative Gene Names

Cwc1, PRL1, Prp46, PRPF46, TANGO4

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein pleiotropic regulator 1
Target Gene PLRG1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GPGVALTADTKIQRMPSESAAQSLAVALPLQTKADANRTAPSGSEYRHPGASDRPQPTAMNSIVMETGNTKNSALMAKKAPTMPKPQWH
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000027998 (92%), Rat ENSRNOG00000006655 (91%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Independent Validation
Independent Validation Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.