Atlas Antibodies Anti-PLRG1 Antibody
| 상품 옵션 정보 | |||||||
|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA061486-100 | Atlas Antibodies HPA061486-100 Anti-PLRG1 Antibody, pleiotropic regulator 1 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
| HPA061486-25 | Atlas Antibodies HPA061486-25 Anti-PLRG1 Antibody, pleiotropic regulator 1 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 | |
다른 상품 둘러보기
Anti-PLRG1 Antibody
pleiotropic regulator 1
Recommended Applications
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human PLRG1
Alternative Gene Names
Cwc1, PRL1, Prp46, PRPF46, TANGO4
Target Protein
pleiotropic regulator 1
Target Gene
PLRG1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
GPGVALTADTKIQRMPSESAAQSLAVALPLQTKADANRTAPSGSEYRHPGASDRPQPTAMNSIVMETGNTKNSALMAKKAPTMPKPQWH
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Mouse ENSMUSG00000027998 (92%)
Rat ENSRNOG00000006655 (91%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|