CacheBy
Atlas Antibodies Anti-PLK5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PLK5 Antibody

상품 한눈에 보기

인간 PLK5 단백질을 인식하는 폴리클로날 항체로, IHC 및 RNA-seq 비교를 통한 Orthogonal 검증 완료. Rabbit 유래 IgG 형태이며, PrEST 항원으로 친화 정제됨. 인간 반응성이 검증되어 신뢰성 높은 단백질 발현 분석에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035024-100 Anti-PLK5 Antibody, polo-like kinase 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035024-25 Anti-PLK5 Antibody, polo-like kinase 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PLK5 Antibody

Anti-PLK5 Antibody

Target: polo-like kinase 5 (PLK5)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against human PLK5.


Alternative Gene Names

PLK5P, SgK384ps

Open Datasheet


Target Information

항목 내용
Target Protein polo-like kinase 5
Target Gene PLK5
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence YTVLTGTPPFMASPLSEMYQNIREGHYPEPAHLSANARRLIVHLLAPNPAERPSLDHLLQDDFFTQ
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000035486 (82%), Rat ENSRNOG00000034102 (79%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.