CacheBy
Atlas Antibodies Anti-PLOD1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PLOD1 Antibody

상품 한눈에 보기

인체 PLOD1 단백질을 인식하는 폴리클로날 항체로, WB에서 RNA-seq 데이터와 비교한 정교한 Orthogonal 검증 제공. Rabbit 유래 IgG 항체로, 친화 정제 방식 사용. 인체에 반응하며 Mouse 및 Rat과 높은 서열 유사성(86%) 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA055799-100 Anti-PLOD1 Antibody, procollagen-lysine, 2-oxoglutarate 5-dioxygenase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055799-25 Anti-PLOD1 Antibody, procollagen-lysine, 2-oxoglutarate 5-dioxygenase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PLOD1 Antibody

Anti-PLOD1 Antibody

Target Protein: procollagen-lysine, 2-oxoglutarate 5-dioxygenase 1
Product Type: Polyclonal Antibody against Human PLOD1

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Alternative Gene Names

  • LH1
  • LLH
  • PLOD

Open Datasheet

Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

YISNIYLIKGSALRGELQSSDLFHHSKLDPDMAFCANIRQQDVFMFLTNRHTLGHLLSLDSYRTTHLHNDLWEVFSN

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Mouse ENSMUSG00000019055 86%
Rat ENSRNOG00000007763 86%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
WB Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.