CacheBy
Atlas Antibodies Anti-PLA2G4A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PLA2G4A Antibody

상품 한눈에 보기

Human PLA2G4A 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. Human에 대해 검증되었으며, Rat 및 Mouse에서도 높은 서열 유사성을 보임.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA050062-100 Anti-PLA2G4A Antibody, phospholipase A2, group IVA (cytosolic, calcium-dependent) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050062-25 Anti-PLA2G4A Antibody, phospholipase A2, group IVA (cytosolic, calcium-dependent) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PLA2G4A Antibody

Anti-PLA2G4A Antibody

Target: phospholipase A2, group IVA (cytosolic, calcium-dependent)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human PLA2G4A.


Alternative Gene Names

  • cPLA2-alpha
  • PLA2G4

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein phospholipase A2, group IVA (cytosolic, calcium-dependent)
Target Gene PLA2G4A
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence TVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSGSQSRGSTMEEELENITTKHIVSNDSSDSDDESHEPKGTENEDAGSDYQ
Verified Species Reactivity Human
Interspecies Identity Rat (89%), Mouse (88%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.